TalkingBass.Net
This is one of the sites we know and all love. It has earned that reputation through Mark’s hard work, love of bass, and passion for teaching. Mark is one of the greats in the online teaching world and for good reason.
This review is coming from a real-world player perspective. I am not trying to sell you a dream or act like every piece of gear turns somebody into a superhero overnight. I just want to tell you what it actually felt like to use this thing in real life.
Review cover coming soon
Quick Take
If you only want the fast answer, start here.
Okay, this site doesn’t get enough love. We all hear about Scott, Mark, and Josh, but we rarely hear about Andrew. Scott, Mark, and Josh have amazing content, and god knows plenty of it, but one thing they don’t give you that Andrew does is a true practice routine AND a true learner’s sequence.
Not everyone needs that, I know, I know, but I’m that guy.
With the amount of information out there, I need more guidance than “Here is the information, and here is how you create a practice routine.” I needed an example or a full practice layout, especially at the beginning.
Andrew and Bass Freedom is probably as close as I have seen to in-person without actually being in person. Andrew will take you on the guided path from zero to hero.
Who This Is For
Who this seems built for once you get past the marketing copy.
Lots of great content for most skill level.s
What You Get
What you are really getting once you log in and start using it.
Great stuff to learn.
Using It in Real Life
The practical, lived-in version. Not the sales page version.
blah blah tgellelllemmemmelcmelmasdlkfmqwer
What I Liked / What I Didn't
No review is useful if it is all hype or all complaining.
What I Liked
Mark is fantastic.
What I Didn't
Some stuff was missing
Should You Buy It?
If you are trying to decide whether this fits your goals, this is the section that matters.
Self-starter
Bottom Line
The simple answer I would give if a friend texted me asking whether it is worth it.
Pretty cool shit.